PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02329.1.g00130.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB_related
Protein Properties Length: 103aa    MW: 11474 Da    PI: 8.4914
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02329.1.g00130.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.41.6e-18855148
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                  +g+WT+ Ed ll ++v+q+G g+W+++a+  g++R++k+c++rw +yl
  Zmw_sc02329.1.g00130.1.am.mk  8 KGPWTAPEDRLLTEYVQQHGEGCWSSVAKLTGLRRSGKSCRLRWVNYL 55
                                  79********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.465159IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.1E-23558IPR009057Homeodomain-like
SMARTSM007173.3E-15757IPR001005SANT/Myb domain
PfamPF002493.8E-17855IPR001005SANT/Myb domain
SuperFamilySSF466894.49E-23983IPR009057Homeodomain-like
CDDcd001671.08E-111055No hitNo description
PROSITE profilePS500905.1115687IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.8E-85987IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 103 aa     Download sequence    Send to blast
MLQGGWRKGP WTAPEDRLLT EYVQQHGEGC WSSVAKLTGL RRSGKSCRLR WVNYLRPDLK  60
RGKITPDEET VILQLHAMLG NSLWRLVDGD NCGAGDGSSG GDY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-168812799MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002465878.12e-48hypothetical protein SORBIDRAFT_01g047450
RefseqXP_015630196.11e-48PREDICTED: transcription factor WER
SwissprotQ9SSA12e-33MYB57_ARATH; Transcription factor MYB57
TrEMBLA0A0E0NPI01e-48A0A0E0NPI0_ORYRU; Uncharacterized protein
TrEMBLI1P7G32e-48I1P7G3_ORYGL; Uncharacterized protein
TrEMBLQ10RX91e-48Q10RX9_ORYSJ; Myb-like DNA-binding domain containing protein
STRINGLOC_Os03g04900.14e-48(Oryza sativa Japonica Group)
STRINGORGLA03G0030900.15e-48(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132282433